PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca21217.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 324aa    MW: 36533.7 Da    PI: 5.9762
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca21217.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.46.5e-40331321100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkCa+dCvlapyfp++++++f n+hklFG+sn++k++k+l+++++++am+++++++++rardPv G++++i++l++q+e  kael+l+ +
  Dca21217.1  33 ACAACKYQRRKCAPDCVLAPYFPHDRQRQFLNAHKLFGVSNITKIIKNLNPQDKDIAMHTIMFQSDVRARDPVGGCYSIIRDLHHQIEFCKAELDLVFQ 131
                 7*********************************************************************************************99877 PP

      DUF260 100 e 100
                 +
  Dca21217.1 132 Q 132
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.05732133IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-3733128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MNNNIINNTL PKTNILNTIS STNHHRISIG TQACAACKYQ RRKCAPDCVL APYFPHDRQR  60
QFLNAHKLFG VSNITKIIKN LNPQDKDIAM HTIMFQSDVR ARDPVGGCYS IIRDLHHQIE  120
FCKAELDLVF QQLAICKAQA FQQHSQLMSI NHQHVVVPPL PHPTFQGVVE EDNNGDNNHN  180
NINNNINGNN EEDNEENYRH YHEMLMRCQY DDGDQGGVQY VGEHESDQFS WTPHDDVVLA  240
SSNSSNSHGD CFIVKQDLGS ECDGFPMKLM RLDSSEPPPY GVSDHVDITC GVTIQSDGIK  300
FGSHPTTQLS EEIVLKENKI MVGN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686136.11e-63PREDICTED: LOB domain-containing protein 22
TrEMBLA0A0J8BY582e-85A0A0J8BY58_BETVU; Uncharacterized protein
STRINGPGSC0003DMT4000124981e-59(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.19e-59LOB domain-containing protein 22